PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005426m
Common NameCARUB_v10005426mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 286aa    MW: 32227.1 Da    PI: 9.1934
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005426mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Carubv10005426m 14 KGAWTKEEDERLIAYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding58.71.3e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Carubv10005426m  67 RGNFTDEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.496961IPR017930Myb domain
SMARTSM007176.2E-141363IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-2913108IPR009057Homeodomain-like
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001674.00E-111661No hitNo description
PROSITE profilePS5129429.01762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2865117IPR009057Homeodomain-like
SMARTSM007171.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.3E-1667111IPR001005SANT/Myb domain
CDDcd001671.04E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLIAYIK SHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLINRG  120
IDPTTHRPIQ ESSSASQDSK PIPQLEPVTS SNTINISFAS APKVETFQES ITFPVKPEKI  180
SMLTFKEERP VEEKFPDLNL ELRISLPDEV DRRQGLLGKS TTPRCFKCSL GMVNGMECRC  240
GRMRCDVVGG SSKGTDMTMS NGFDFLGLAK KETTSLMGFR SLEMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628600.0AF062860.2 Arabidopsis thaliana putative transcription factor (MYB4) mRNA, MYB4-Col allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284260.10.0hypothetical protein CARUB_v10005426mg
SwissprotQ9SZP10.0MYB4_ARATH; Transcription repressor MYB4
TrEMBLR0H1220.0R0H122_9BRAS; Uncharacterized protein
STRINGAT4G38620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.10.0myb domain protein 4